What is the catalog number for Apolipoprotein E4 (R251G) Human, Recombinant?

The catalog number for Apolipoprotein E4 (R251G) Human, Recombinant is orb2719838.

What sizes are available for Apolipoprotein E4 (R251G) Human, Recombinant?

Apolipoprotein E4 (R251G) Human, Recombinant is available in the following size(s): 1 mg.

Is Apolipoprotein E4 (R251G) Human, Recombinant in stock?

Apolipoprotein E4 (R251G) Human, Recombinant is currently made to order / not held in immediate stock. Contact us for lead time.

Apolipoprotein E4 (R251G) Human, Recombinant

Apolipoprotein E4 (R251G) (1.0 mg) Human, Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Field of Research

Metabolism Research

Purity

>95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

ApoE is soluble in PBS.

Molecular Weight

34321.79 Da

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIGLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH