What is the catalog number for Apolipoprotein E3 (R251) Human, Recombinant?

The catalog number for Apolipoprotein E3 (R251) Human, Recombinant is orb2719836.

What sizes are available for Apolipoprotein E3 (R251) Human, Recombinant?

Apolipoprotein E3 (R251) Human, Recombinant is available in the following size(s): 1 mg.

Is Apolipoprotein E3 (R251) Human, Recombinant in stock?

Apolipoprotein E3 (R251) Human, Recombinant is currently made to order / not held in immediate stock. Contact us for lead time.

Apolipoprotein E3 (R251) Human, Recombinant

Apolipoprotein E3 (R251) (1.0 mg) Human, Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Field of Research

Metabolism Research

Purity

>95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

ApoE is soluble in PBS.

Molecular Weight

34268.74 Da

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIGLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH