Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein E3 (ApoE3) 1-272 Human, Recombinant

Apolipoprotein E3 (ApoE3) (1mg) 1-272 Human, Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Field of Research

Metabolism Research

Purity

95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

ApoE is soluble in PBS.

Molecular Weight

31.5 kDa

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSS QVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMED VCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKCLAVYQAGA REGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMG SRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse SLC6A2 Protein, His (Fc)-Avi-tagged
SLC6A2-8409M 50 µg

Recombinant Mouse SLC6A2 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Pts 3'UTR Lenti-reporter-Luc Vector
38196086 1.0 µg

Pts 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
BACH2 (NM_001170794) Human Tagged Lenti ORF Clone
RC230535L4 10 µg

BACH2 (NM_001170794) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
4930555I21Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4636908 1.0 µg DNA

4930555I21Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Mouse Transmembrane protein 74 (TMEM74) ELISA Kit
abx550563 96 Tests

Mouse Transmembrane protein 74 (TMEM74) ELISA Kit

Sign In for Pricing
View Details
α- (1-Methylethyl) -9-phenanthrenemethanol
OR1093337-01 250 mg

α- (1-Methylethyl) -9-phenanthrenemethanol

Sign In for Pricing
View Details