Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein E3 (ApoE3) 1-272 Human, Recombinant

Apolipoprotein E3 (ApoE3) (1mg) 1-272 Human, Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Field of Research

Metabolism Research

Purity

95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

ApoE is soluble in PBS.

Molecular Weight

31.5 kDa

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSS QVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMED VCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKCLAVYQAGA REGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMG SRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Streptomyces coelicolor Tryptophan--tRNA ligase 2 (trpS2)
MBS1361585-01 0.02 mg (E-Coli)

Recombinant Streptomyces coelicolor Tryptophan--tRNA ligase 2 (trpS2)

Sign In for Pricing
View Details
Recombinant Streptomyces coelicolor Tryptophan--tRNA ligase 2 (trpS2)
MBS1361585-02 0.02 mg (Yeast)

Recombinant Streptomyces coelicolor Tryptophan--tRNA ligase 2 (trpS2)

Sign In for Pricing
View Details
Recombinant Streptomyces coelicolor Tryptophan--tRNA ligase 2 (trpS2)
MBS1361585-03 0.1 mg (E-Coli)

Recombinant Streptomyces coelicolor Tryptophan--tRNA ligase 2 (trpS2)

Sign In for Pricing
View Details
Recombinant Streptomyces coelicolor Tryptophan--tRNA ligase 2 (trpS2)
MBS1361585-04 0.1 mg (Yeast)

Recombinant Streptomyces coelicolor Tryptophan--tRNA ligase 2 (trpS2)

Sign In for Pricing
View Details
Recombinant Streptomyces coelicolor Tryptophan--tRNA ligase 2 (trpS2)
MBS1361585-05 0.02 mg (Baculovirus)

Recombinant Streptomyces coelicolor Tryptophan--tRNA ligase 2 (trpS2)

Sign In for Pricing
View Details
Recombinant Streptomyces coelicolor Tryptophan--tRNA ligase 2 (trpS2)
MBS1361585-06 0.02 mg (Mammalian-Cell)

Recombinant Streptomyces coelicolor Tryptophan--tRNA ligase 2 (trpS2)

Sign In for Pricing
View Details