Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein E3 (ApoE3) 1-132 Human, Recombinant

Apolipoprotein E3 (ApoE3) 1-132 (1.0 mg) Human, Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Field of Research

Metabolism Research

Purity

>95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

ApoE is soluble in PBS.

Molecular Weight

15491.34 Da

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQE ELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQA RLGADMEDVCGRLVQYRGEVQAMLGQSTEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transmembrane protein 93 (EMC6) (NM_001014764) Human Over-expression Lysate
LC423076 20 µg

Transmembrane protein 93 (EMC6) (NM_001014764) Human Over-expression Lysate

Sign In for Pricing
View Details
S100B Polyclonal Antibody
D-AB-10118L-01 25 µL

S100B Polyclonal Antibody

Sign In for Pricing
View Details
S100B Polyclonal Antibody
D-AB-10118L-02 100 µL

S100B Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS712564 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
CORO7 (NM_024535) Human Recombinant Protein
TP324038 20 µg

CORO7 (NM_024535) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant CDC34 Antibody
RC-5651-01 50 μL

Recombinant CDC34 Antibody

Sign In for Pricing
View Details