Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein E3 (ApoE3) 1-132 Human, Recombinant

Apolipoprotein E3 (ApoE3) 1-132 (1.0 mg) Human, Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Field of Research

Metabolism Research

Purity

>95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

ApoE is soluble in PBS.

Molecular Weight

15491.34 Da

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQE ELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQA RLGADMEDVCGRLVQYRGEVQAMLGQSTEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RICTOR (N-term) Rabbit Polyclonal Antibody
AP13961PU-N 400 µL

RICTOR (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS800962 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
6Alpha-Hydroxy Gestrinone
TRC-H942783-2.5MG 2.5 mg

6Alpha-Hydroxy Gestrinone

Sign In for Pricing
View Details
RAB36 Rabbit Polyclonal Antibody
TA362285 100 µL

RAB36 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS806510 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD11c Antibody[3.9]
E-AB-F14860-01 100 µg

AF/LE Purified Anti-Human CD11c Antibody[3.9]

Sign In for Pricing
View Details