What is the catalog number for Apolipoprotein E2 (ApoE2) 1-132 Human, Recombinant?

The catalog number for Apolipoprotein E2 (ApoE2) 1-132 Human, Recombinant is orb2719830.

What sizes are available for Apolipoprotein E2 (ApoE2) 1-132 Human, Recombinant?

Apolipoprotein E2 (ApoE2) 1-132 Human, Recombinant is available in the following size(s): 1 mg.

Is Apolipoprotein E2 (ApoE2) 1-132 Human, Recombinant in stock?

Apolipoprotein E2 (ApoE2) 1-132 Human, Recombinant is currently made to order / not held in immediate stock. Contact us for lead time.

Apolipoprotein E2 (ApoE2) 1-132 Human, Recombinant

Apolipoprotein E2 (ApoE2) 1-132 (1.0 mg) Human, Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Field of Research

Metabolism Research

Purity

>95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

ApoE is soluble in PBS.

Molecular Weight

15491.34 Da

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQE ELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQA RLGADMEDVCGRLVQYRGEVQAMLGQSTEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

orb1925895-01 50 µL

LIPF Antibody (Center)

Sign In for Pricing

View Details

orb1925895-02 100 µL

LIPF Antibody (Center)

Sign In for Pricing

View Details

MBS575467 Inquire

Galunisertib (LY2157299)

Sign In for Pricing

View Details

MBS6399659-01 0.1 mL

ANXA7 (Synexin, Annexin VII, Annexin-7, Annexin A7, ANX7, SNX, OK/SW-cl.95) (Biotin)

Sign In for Pricing

View Details

MBS6399659-02 5x 0.1 mL

ANXA7 (Synexin, Annexin VII, Annexin-7, Annexin A7, ANX7, SNX, OK/SW-cl.95) (Biotin)

Sign In for Pricing

View Details

GTR15419087 1 Vial

Human BARHL1 Knockout HEK293T cell line

Sign In for Pricing

View Details