Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein E2 (ApoE2) 1-132 Human, Recombinant

Apolipoprotein E2 (ApoE2) 1-132 (1.0 mg) Human, Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Field of Research

Metabolism Research

Purity

>95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

ApoE is soluble in PBS.

Molecular Weight

15491.34 Da

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQE ELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQA RLGADMEDVCGRLVQYRGEVQAMLGQSTEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHROOM2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
43734111 3x 1.0 µg

SHROOM2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Anti-Zebrafish ALDH2.1/2.2 Antibody Picoband® Fluoro594 Conjugated
AZQ7SXU3-Fluoro594 100 µg/Vial

Anti-Zebrafish ALDH2.1/2.2 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Tris (isopropyl) silyl chloride
OR0155-01 100 g

Tris (isopropyl) silyl chloride

Sign In for Pricing
View Details
Tris (isopropyl) silyl chloride
OR0155-02 500 g

Tris (isopropyl) silyl chloride

Sign In for Pricing
View Details
HERPUD1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-15464R-BF750 100 µL

HERPUD1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
ZNF197, NT (ZNF197, ZKSCAN9, ZNF166, Zinc finger protein 197, Zinc finger protein with KRAB and SCAN domains 9, ZnF20, pVHL-associated KRAB domain-containing protein) (MaxLight 550)
MBS6365806-01 0.1 mL

ZNF197, NT (ZNF197, ZKSCAN9, ZNF166, Zinc finger protein 197, Zinc finger protein with KRAB and SCAN domains 9, ZnF20, pVHL-associated KRAB domain-containing protein) (MaxLight 550)

Sign In for Pricing
View Details