Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha-Synuclein (A140C) Human, Recombinant

Alpha-Synuclein (A140C) (1.0 mg) Human, Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Field of Research

Neuroscience

Purity

95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

Alpha-Synuclein is readily soluble in PBS.

Molecular Weight

14492Da

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKKGVVHGVAT VAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQ EGILEDMPVDPDNEAYEMPSEEGYQDYEPEC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat cAMP response element-binding protein (CREB) ELISA Kit
MBS7249731-01 48 Well

Goat cAMP response element-binding protein (CREB) ELISA Kit

Sign In for Pricing
View Details
Goat cAMP response element-binding protein (CREB) ELISA Kit
MBS7249731-02 96 Well

Goat cAMP response element-binding protein (CREB) ELISA Kit

Sign In for Pricing
View Details
Goat cAMP response element-binding protein (CREB) ELISA Kit
MBS7249731-03 5x 96 Well

Goat cAMP response element-binding protein (CREB) ELISA Kit

Sign In for Pricing
View Details
Goat cAMP response element-binding protein (CREB) ELISA Kit
MBS7249731-04 10x 96 Well

Goat cAMP response element-binding protein (CREB) ELISA Kit

Sign In for Pricing
View Details
Research Grade Anti-Human CD22 (SM06)
DHD38517 100 μg

Research Grade Anti-Human CD22 (SM06)

Sign In for Pricing
View Details
(S) -4-tert-Butyl-2-oxazolidinone
FT46528-01 25 g

(S) -4-tert-Butyl-2-oxazolidinone

Sign In for Pricing
View Details