Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aspergillus fumigatus Protein ecm33 (ecm33)

Product Specifications

Abbreviation

Recombinant Aspergillus fumigatus ecm33 protein

Gene Name

Ecm33

UniProt

Q4WNS8

Expression Region

20-372aa

Organism

Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata)

Target Sequence

ANCGKTDETITISSQSDADGYSSCSTIKGTIEIDEHLSGAITFNNVKQIDGTLSCTGGANISSIAAPMLNSIADTFKLDGLTTLTTLSFPSLTSVGSIQWTALPQLQSLDFTKGVNEAGDVTITNTGLANLNGISLNTVGKFDITENTQLKSININNLKNATGLINFAGNLNSLEVELPNLSSGTNMTFRNVSAVSVPSLHNLTGQLGFWGDTFKSFSAPNLTETGDLVFNSNSKLTNISMPALETVNGGFLITRNDELSSIDLPSLKVVTGAVDFSGKFDEVSMPKLENVKGQFNLQSTGNFSCDTFDKAHNDKVIRGTYKCKAAEPNPTTKDGSSGTTTSSGSSASASKSN

Tag

C-terminal hFc1-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Involved in conidial and mycelial cell wall biogenesis.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

65.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSC, CT (MSC, ABF1, BHLHA22, Musculin, Activated B Cell factor 1, Class A basic helix-loop-helix protein 22) (Azide free) (HRP) discontinued
038626-HRP 200 µL

MSC, CT (MSC, ABF1, BHLHA22, Musculin, Activated B Cell factor 1, Class A basic helix-loop-helix protein 22) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal ETS1 associated protein II Antibody [FITC]
NB600-247F 0.1 mL

Rabbit Polyclonal ETS1 associated protein II Antibody [FITC]

Sign In for Pricing
View Details
CD99L2 Protein Vector (Human) (pPB-C-His)
PV008605 500 ng

CD99L2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
(R) -Baclofen discontinued
217728 10 mg

(R) -Baclofen discontinued

Sign In for Pricing
View Details
IGFBP3 sgRNA CRISPR Lentivector (Human) (Target 1)
K1025502 1.0 µg DNA

IGFBP3 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human Cholinergic Receptor, Nicotinic, Beta 2 (CHRNb2) ELISA Kit
MBS458374-01 48 Tests

Human Cholinergic Receptor, Nicotinic, Beta 2 (CHRNb2) ELISA Kit

Sign In for Pricing
View Details