Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Corticotropin Releasing Factor, bovine

CRF, bovine is a potent agonist of CRF receptor, and displaces [125I-Tyr]ovine CRF with a Ki of 3.52 nM.

Product Specifications

Field of Research

Pharmacology & Drug Discovery

Purity

≥95%

Molecular Weight

4697.44

Notes

For research use only.

AA Sequence

SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4-Dinitrobenzyl Bromide
TRC-D680470-500MG 500 mg

2,4-Dinitrobenzyl Bromide

Sign In for Pricing
View Details
Mouse Asic2 activation kit by CRISPRa
GA200018 1 Kit

Mouse Asic2 activation kit by CRISPRa

Sign In for Pricing
View Details
5-Bromo-7-ethyl-2-formyl-benzofuran
TRC-B684245-25MG 25 mg

5-Bromo-7-ethyl-2-formyl-benzofuran

Sign In for Pricing
View Details
Avermectin A1b (>85%)
TRC-A847910-1MG 1 mg

Avermectin A1b (>85%)

Sign In for Pricing
View Details
TAG-72 / CA72.4 (Tumor-Associated Glycoprotein) (CA72/2869R), CF647 conjugate, 0.1mg/mL
BNC472869-100 1x 100 µL

TAG-72 / CA72.4 (Tumor-Associated Glycoprotein) (CA72/2869R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NSE (ENO2) Rabbit Polyclonal Antibody
AP12427PU-N 400 µL

NSE (ENO2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details