Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Corticotropin Releasing Factor, bovine

CRF, bovine is a potent agonist of CRF receptor, and displaces [125I-Tyr]ovine CRF with a Ki of 3.52 nM.

Product Specifications

Field of Research

Pharmacology & Drug Discovery

Purity

≥95%

Molecular Weight

4697.44

Notes

For research use only.

AA Sequence

SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AIF1 / Iba1 (Microglia Marker) (AIF1/2493), CF488A conjugate, 0.1mg/mL
BNC882493-500 1x 500 µL

AIF1 / Iba1 (Microglia Marker) (AIF1/2493), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Phospho-TSC1 Antibody (pY297)
F48830-0.4ML 0.4 mL

Phospho-TSC1 Antibody (pY297)

Sign In for Pricing
View Details
3-Acetylacetanilide
TRC-A133000-250MG 250 mg

3-Acetylacetanilide

Sign In for Pricing
View Details
Tyrosinase (T311 + OCA1/812), CF568 conjugate, 0.1mg/mL
BNC680908-500 1x 500 µL

Tyrosinase (T311 + OCA1/812), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS707109 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
4-(Quinoline-8-sulfonamido)benzoic Acid
TRC-E592265-250MG 250 mg

4-(Quinoline-8-sulfonamido)benzoic Acid

Sign In for Pricing
View Details