Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Corticotropin Releasing Factor, bovine

CRF, bovine is a potent agonist of CRF receptor, and displaces [125I-Tyr]ovine CRF with a Ki of 3.52 nM.

Product Specifications

Field of Research

Pharmacology & Drug Discovery

Purity

≥95%

Molecular Weight

4697.44

Notes

For research use only.

AA Sequence

SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

beta-Hyodeoxycholic Acid-d4
TRC-H998107-25MG 25 mg

beta-Hyodeoxycholic Acid-d4

Sign In for Pricing
View Details
1110059G10Rik (NM_025419) Mouse Tagged ORF Clone
MG201156 10 µg

1110059G10Rik (NM_025419) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
LRRC3 Antibody
OC-656-01 50 μL

LRRC3 Antibody

Sign In for Pricing
View Details
LRRC3 Antibody
OC-656-02 100 µL

LRRC3 Antibody

Sign In for Pricing
View Details
LRRC3 Antibody
OC-656-03 1 mL

LRRC3 Antibody

Sign In for Pricing
View Details
Vimentin Antibody
F48162-0.08ML 0.08 mL

Vimentin Antibody

Sign In for Pricing
View Details