Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PACAP (1-38), human, ovine, rat

PACAP (1-38), human, ovine, rat is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively.

Product Specifications

Purity

≥95%

Solubility

Water: 100 mg/mL

Molecular Weight

4534.36

Notes

For research use only.

AA Sequence

HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Bromobenzoic Acid
TRC-B680500-25G 25 g

2-Bromobenzoic Acid

Sign In for Pricing
View Details
SEZ6L2 Antibody
KC-3437-01 50 μL

SEZ6L2 Antibody

Sign In for Pricing
View Details
SEZ6L2 Antibody
KC-3437-02 100 µL

SEZ6L2 Antibody

Sign In for Pricing
View Details
SEZ6L2 Antibody
KC-3437-03 1 mL

SEZ6L2 Antibody

Sign In for Pricing
View Details
4-Hydroxyquinazoline
TRC-H941415-5G 5 g

4-Hydroxyquinazoline

Sign In for Pricing
View Details
Frozen Tissue Blocks, Cecum
CB511440 1 Block

Frozen Tissue Blocks, Cecum

Sign In for Pricing
View Details