Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PACAP (1-38), human, ovine, rat

PACAP (1-38), human, ovine, rat is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively.

Product Specifications

Purity

≥95%

Solubility

Water: 100 mg/mL

Molecular Weight

4534.36

Notes

For research use only.

AA Sequence

HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL
BNC400181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL
BNC680978-500 1x 500 µL

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (C31/1395R), CF640R conjugate, 0.1mg/mL
BNC401395-500 1x 500 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (C31/1395R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1718), CF488A conjugate, 0.1mg/mL
BNC881718-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1718), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100B (4C4.9), CF647 conjugate, 0.1mg/mL
BNC470143-500 1x 500 µL

S100B (4C4.9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (KIP1/769), CF568 conjugate, 0.1mg/mL
BNC680769-500 1x 500 µL

P27 / KIP1 (KIP1/769), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details