Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PACAP (1-38), human, ovine, rat

PACAP (1-38), human, ovine, rat is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively.

Product Specifications

Purity

≥95%

Solubility

Water: 100 mg/mL

Molecular Weight

4534.36

Notes

For research use only.

AA Sequence

HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mix-n-StainTM CF®710 Antibody Labeling Kit, 1x (5-20ug) labeling
#92579 1 Kit

Mix-n-StainTM CF®710 Antibody Labeling Kit, 1x (5-20ug) labeling

Sign In for Pricing
View Details
Human MYO (Myoglobin) CLIA Kit
E-CL-H0134-01 24 Tests

Human MYO (Myoglobin) CLIA Kit

Sign In for Pricing
View Details
Human MYO (Myoglobin) CLIA Kit
E-CL-H0134-02 48 Tests

Human MYO (Myoglobin) CLIA Kit

Sign In for Pricing
View Details
Human MYO (Myoglobin) CLIA Kit
E-CL-H0134-03 96 Tests

Human MYO (Myoglobin) CLIA Kit

Sign In for Pricing
View Details
SYK Rabbit Polyclonal Antibody
HA500080 100 µL

SYK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UNC119B Human Gene Knockout Kit (CRISPR)
KN419902 1 Kit

UNC119B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details