Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Exendin 3

Exendin-3 is a biologically active peptides isolated from venoms of the Gila monster lizards, Heloderma horridurn.

Product Specifications

Purity

≥95%

Molecular Weight

4202.66

Notes

For research use only.

AA Sequence

HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ras-specific guanine nucleotide-releasing factor 1, RASGRF1 ELISA Kit
MBS9332609-01 48 Well

Mouse Ras-specific guanine nucleotide-releasing factor 1, RASGRF1 ELISA Kit

Sign In for Pricing
View Details
Mouse Ras-specific guanine nucleotide-releasing factor 1, RASGRF1 ELISA Kit
MBS9332609-02 96 Well

Mouse Ras-specific guanine nucleotide-releasing factor 1, RASGRF1 ELISA Kit

Sign In for Pricing
View Details
Mouse Ras-specific guanine nucleotide-releasing factor 1, RASGRF1 ELISA Kit
MBS9332609-03 5x 96 Well

Mouse Ras-specific guanine nucleotide-releasing factor 1, RASGRF1 ELISA Kit

Sign In for Pricing
View Details
Mouse Ras-specific guanine nucleotide-releasing factor 1, RASGRF1 ELISA Kit
MBS9332609-04 10x 96 Well

Mouse Ras-specific guanine nucleotide-releasing factor 1, RASGRF1 ELISA Kit

Sign In for Pricing
View Details
SRRM4 Antibody, Biotin conjugated
CSB-PA012292LD01HU-01 50 µg

SRRM4 Antibody, Biotin conjugated

Sign In for Pricing
View Details
SRRM4 Antibody, Biotin conjugated
CSB-PA012292LD01HU-02 100 µg

SRRM4 Antibody, Biotin conjugated

Sign In for Pricing
View Details