Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Exendin 3

Exendin-3 is a biologically active peptides isolated from venoms of the Gila monster lizards, Heloderma horridurn.

Product Specifications

Purity

≥95%

Molecular Weight

4202.66

Notes

For research use only.

AA Sequence

HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXO1A (Forkhead Box O1, FKH1, FKHR, FOXO1A) (FITC)
MBS6176420-01 0.1 mL

FOXO1A (Forkhead Box O1, FKH1, FKHR, FOXO1A) (FITC)

Sign In for Pricing
View Details
FOXO1A (Forkhead Box O1, FKH1, FKHR, FOXO1A) (FITC)
MBS6176420-02 5x 0.1 mL

FOXO1A (Forkhead Box O1, FKH1, FKHR, FOXO1A) (FITC)

Sign In for Pricing
View Details
IPP Rabbit Polyclonal Antibody (Cy5)
orb946630 100 µL

IPP Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Calcium channel-modulator-1
M32746-01 1 g

Calcium channel-modulator-1

Sign In for Pricing
View Details
Calcium channel-modulator-1
M32746-02 500 mg

Calcium channel-modulator-1

Sign In for Pricing
View Details
Calcium channel-modulator-1
M32746-03 5 mg

Calcium channel-modulator-1

Sign In for Pricing
View Details