Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Exendin 3

Exendin-3 is a biologically active peptides isolated from venoms of the Gila monster lizards, Heloderma horridurn.

Product Specifications

Purity

≥95%

Molecular Weight

4202.66

Notes

For research use only.

AA Sequence

HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cpeb4 ORF Vector (Rat) (pORF)
ORF065365 1.0 µg DNA

Cpeb4 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
CD46 Antibody
orb1151880-01 20 µg

CD46 Antibody

Sign In for Pricing
View Details
CD46 Antibody
orb1151880-02 100 µg

CD46 Antibody

Sign In for Pricing
View Details
Recombinant Eosinophil Chemotactic Factor (ECF)
MBS2031840-01 0.01 mg

Recombinant Eosinophil Chemotactic Factor (ECF)

Sign In for Pricing
View Details
Recombinant Eosinophil Chemotactic Factor (ECF)
MBS2031840-02 0.05 mg

Recombinant Eosinophil Chemotactic Factor (ECF)

Sign In for Pricing
View Details
Recombinant Eosinophil Chemotactic Factor (ECF)
MBS2031840-03 0.1 mg

Recombinant Eosinophil Chemotactic Factor (ECF)

Sign In for Pricing
View Details