Urocortin II, mouse
Urocortin II, mouse is a potent and selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor with Ki values of 0.66 nM and >100 nM for CRFR2 and CRFR1, respectively. Urocortin II, mouse activates CRF2 receptors in a cAMP/PKA- and Ca2+/CaMKII-dependent manner.Urocortin II, mouse is expressed in discrete areas of the central nervous system, and activates central neurons involved in the processing of visceral sensory information, and in modulating autonomic outflow.
Product Specifications
Purity
≥95%
Molecular Weight
4152.98
Notes
For research use only.
AA Sequence
VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV-NH2
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
127087-ML550 100 µL
GABPB1 (GA-binding Protein Subunit beta-1, GABP Subunit beta-1, GABPB-1, GABP Subunit beta-2, GABPB-2, Nuclear Respiratory Factor 2, Transcription Factor E4TF1-47, Transcription Factor E4TF1-53, E4TF1B, GABPB, GABPB2) (MaxLight 550)
Sign In for Pricing
View Details 
MBS6424952-01 0.1 mL
LSM1 (U6 snRNA-associated Sm-like Protein LSm1, Sm-like Protein 1, Cancer-associated Sm-like, CASM, YJL124C) (MaxLight 550)
Sign In for Pricing
View Details MBS6424952-02 5x 0.1 mL
LSM1 (U6 snRNA-associated Sm-like Protein LSm1, Sm-like Protein 1, Cancer-associated Sm-like, CASM, YJL124C) (MaxLight 550)
Sign In for Pricing
View Details