Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Urocortin II, mouse

Urocortin II, mouse is a potent and selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor with Ki values of 0.66 nM and >100 nM for CRFR2 and CRFR1, respectively. Urocortin II, mouse activates CRF2 receptors in a cAMP/PKA- and Ca2+/CaMKII-dependent manner.Urocortin II, mouse is expressed in discrete areas of the central nervous system, and activates central neurons involved in the processing of visceral sensory information, and in modulating autonomic outflow.

Product Specifications

Purity

≥95%

Molecular Weight

4152.98

Notes

For research use only.

AA Sequence

VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KHK/Ketohexokinase ELISA Kit
E1372Hu 96 Tests

Human KHK/Ketohexokinase ELISA Kit

Sign In for Pricing
View Details
ENO3 Rabbit pAb
MBS9142290-01 0.02 mL

ENO3 Rabbit pAb

Sign In for Pricing
View Details
ENO3 Rabbit pAb
MBS9142290-02 0.1 mL

ENO3 Rabbit pAb

Sign In for Pricing
View Details
ENO3 Rabbit pAb
MBS9142290-03 5x 0.1 mL

ENO3 Rabbit pAb

Sign In for Pricing
View Details
FBXO33 Human shRNA Plasmid Kit (Locus ID 254170)
TR304554 1 Kit

FBXO33 Human shRNA Plasmid Kit (Locus ID 254170)

Sign In for Pricing
View Details
Ucp1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7526005 3x 1.0 µg

Ucp1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details