Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Urocortin II, mouse

Urocortin II, mouse is a potent and selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor with Ki values of 0.66 nM and >100 nM for CRFR2 and CRFR1, respectively. Urocortin II, mouse activates CRF2 receptors in a cAMP/PKA- and Ca2+/CaMKII-dependent manner.Urocortin II, mouse is expressed in discrete areas of the central nervous system, and activates central neurons involved in the processing of visceral sensory information, and in modulating autonomic outflow.

Product Specifications

Purity

≥95%

Molecular Weight

4152.98

Notes

For research use only.

AA Sequence

VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGD2 (NM_173558) Human Tagged Lenti ORF Clone
RC205644L3 10 µg

FGD2 (NM_173558) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Muc15 shRNA (UAS) - Lentiviral mouse Muc15 shRNA (UAS, iRFP) (25)
GTR15225950 1 Vial

Lentiviral mouse Muc15 shRNA (UAS) - Lentiviral mouse Muc15 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
MAGEE2 Antibody
OAGA06651-100UL 100 µL

MAGEE2 Antibody

Sign In for Pricing
View Details
RK 24466
C06955-100mg 100 mg

RK 24466

Sign In for Pricing
View Details
Lentiviral human NXNL1 shRNA (UAS) - Lentiviral human NXNL1 shRNA (UAS, iRFP) (100)
GTR15122727 1 Vial

Lentiviral human NXNL1 shRNA (UAS) - Lentiviral human NXNL1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Rabbit Polyclonal DAD1 Antibody [Janelia Fluor 549]
NBP1-77197JF549 0.1 mL

Rabbit Polyclonal DAD1 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details