Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, guinea pig

VIP Guinea pig (Vasoactive intestinal peptide), a trophic and mitogenic factor, stimulates growth in whole cultured embryos. VIP Guinea pig functions as a simple gastrointestinal hormone and suggest a possible neurotransmitter function.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

3344.93

Notes

For research use only.

AA Sequence

HSDALFTDTYTRLRKQMAMKKYLNSVLN-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCN1 Antibody Blocking peptide
orb1456279 500 µg

HCN1 Antibody Blocking peptide

Sign In for Pricing
View Details
Lentiviral mouse Izumo2 shRNA (UAS) - Lentiviral mouse Izumo2 shRNA (UAS, iRFP) (100)
GTR15271587 1 Vial

Lentiviral mouse Izumo2 shRNA (UAS) - Lentiviral mouse Izumo2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
BRIX1 Adenovirus (Human)
13481051 1.0 mL

BRIX1 Adenovirus (Human)

Sign In for Pricing
View Details
Porcine Brain Derived Neurotrophic Factor (BDNF) ELISA Kit-Sandwich
EK9F972-01 48 Test

Porcine Brain Derived Neurotrophic Factor (BDNF) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Porcine Brain Derived Neurotrophic Factor (BDNF) ELISA Kit-Sandwich
EK9F972-02 96 Tests

Porcine Brain Derived Neurotrophic Factor (BDNF) ELISA Kit-Sandwich

Sign In for Pricing
View Details
EcoQprepTM Genomic DNA Kit
K-3701-1 200 Reactions

EcoQprepTM Genomic DNA Kit

Sign In for Pricing
View Details