Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP, guinea pig

VIP Guinea pig (Vasoactive intestinal peptide), a trophic and mitogenic factor, stimulates growth in whole cultured embryos. VIP Guinea pig functions as a simple gastrointestinal hormone and suggest a possible neurotransmitter function.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

3344.93

Notes

For research use only.

AA Sequence

HSDALFTDTYTRLRKQMAMKKYLNSVLN-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A37 Antibody (C-term)
MBS9210193-01 0.08 mL

SLC25A37 Antibody (C-term)

Sign In for Pricing
View Details
SLC25A37 Antibody (C-term)
MBS9210193-02 0.4 mL

SLC25A37 Antibody (C-term)

Sign In for Pricing
View Details
SLC25A37 Antibody (C-term)
MBS9210193-03 5x 0.4 mL

SLC25A37 Antibody (C-term)

Sign In for Pricing
View Details
BLZF1 Protein Vector (Mouse) (pPM-C-His)
PV159537 500 ng

BLZF1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Cdc23 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6438908 1.0 µg DNA

Cdc23 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
PYGL CRISPR Activation Plasmid (h)
sc-401950-ACT 20 µg

PYGL CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details