Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNP-32, human

B-type (Brain) natriuretic peptide (BNP) is a 32 amino acid hormone initially isolated from the porcine brain, but mainly produced by the heart ventricles. It is released from a prepro-hormone after cleavage of a signal peptide and further processing by a protease with a conserved recognition sequence (RXXR-S) . This cleavage generated NT-proBNP (76aa) and the biologically active 32aa BNP-32, which are secreted in blood in equimolar concentrations. BNP-32 is secreted by cardiomyocytes in response to myocardial stretch and overload resulting from hypervolaemia and increased blood pressure. It is known to oppose the renin-angiotensin-aldosterone system and exert vasodilatory effects. This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides.

Product Specifications

Purity

≥95%

Molecular Weight

3464.1

Notes

For research use only.

AA Sequence

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX20 Antibody
E306489 100 µg - 200 µL

DDX20 Antibody

Sign In for Pricing
View Details
Snrk (NM_138833) Rat Tagged Lenti ORF Clone
RR212709L4 10 µg

Snrk (NM_138833) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human Prodynorphin, Pro-Dyn ELISA Kit
YLA3974HU-01 48 Tests

Human Prodynorphin, Pro-Dyn ELISA Kit

Sign In for Pricing
View Details
Human Prodynorphin, Pro-Dyn ELISA Kit
YLA3974HU-02 96 Tests

Human Prodynorphin, Pro-Dyn ELISA Kit

Sign In for Pricing
View Details
Magic™ Membrane Protein Human TMEM260 (Transmembrane protein 260) Full Length
MPC1564K Each

Magic™ Membrane Protein Human TMEM260 (Transmembrane protein 260) Full Length

Sign In for Pricing
View Details
5' DY-480XL / 3' BHQ-2
orb1733478 20 to 29 nmol

5' DY-480XL / 3' BHQ-2

Sign In for Pricing
View Details