Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PACAP-27 (human, mouse, ovine, porcine, rat)

PACAP (1-27), human, ovine, rat (PACAP 1-27) is the N-terminal fragment of PACAP-38, and is a potent PACAP receptor antagonist with IC50s of 3 nM, 2 nM and 5 nM for rat PAC1, rat VPAC1 and human VPAC2, respectively. Radioligand receptor binding assays with I-monoiodinated PACAP (1-27), human, ovine, rat confirms the presence of PAC -receptors on AR4-2J cells, since PACAP (1-27), human, ovine, rat and PACAP (1–38) equipotently displaces radioligand binding with a Kd of 1-2 nM, whereas vasoactive intestinal peptide (VIP) is 1000-fold less potent. PACAP (1-27), human, ovine, rat exhibits a distinct and much higher susceptibility to VIP-amino acid substitutions. PACAP (1-27), human, ovine, rat has potency and binding affinity to stimulate IP3 and cAMP formation in AR4-2J cells. The inhibitory effect of pituitary adenylate cyclase activating polypeptide (PACAP (1-27), human, ovine, rat) on the increase in total pulmonary resistance (RL) causes either by allergen or histamine in anaesthetized, ventilated guinea-pigs is studied. PACAP (1-27), human, ovine, rat given via i.v. infusion (0.045-4.5 nmol/kg/min) dose-dependently reduces the increase in RL caused by inhaled ovalbumin and histamine. At the highest dose, PACAP (1-27), human, ovine, rat prevented the increase in RL caused by ovalbumin and histamine completely. Infusion of PACAP (1-27), human, ovine, rat and the β2-adrenoceptor agonist, salbutamol (0.045-4.5 nmol/kg/min) inhibit the increase in RL similarly, but salbutamol increases the heart rate more than PACAP (1-27), human, ovine, rat.

Product Specifications

Purity

≥95%

Molecular Weight

3147.68

Notes

For research use only.

AA Sequence

HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEATR4 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-15439R-PerCP-Cy5.5 100 µL

HEATR4 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
HTATIP2 Human
OM300147-01 20 µg

HTATIP2 Human

Sign In for Pricing
View Details
HTATIP2 Human
OM300147-02 5 µg

HTATIP2 Human

Sign In for Pricing
View Details
HTATIP2 Human
OM300147-03 1 mg

HTATIP2 Human

Sign In for Pricing
View Details
HLA-DRB4 Recombinant Antibody, PE-Cy7 Conjugated
bsm-62445R-PE-Cy7 100 µL

HLA-DRB4 Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Lentiviral human KLHDC8A sgRNA gene knockout kit - Lentiviral human KLHDC8A sgRNA gene knockout kit (100)
GTR15397846 1 Vial

Lentiviral human KLHDC8A sgRNA gene knockout kit - Lentiviral human KLHDC8A sgRNA gene knockout kit (100)

Sign In for Pricing
View Details