Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTH (1-39), human

Adrenocorticotropic Hormone (ACTH) (1-39), human is a melanocortin receptor agonist.

Product Specifications

Purity

≥95%

Solubility

Water: ≥ 50 mg/mL

Molecular Weight

4541.1

Notes

For research use only.

AA Sequence

SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C15orf32 Rabbit Polyclonal Antibody
orb3071692-01 30 µL

C15orf32 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C15orf32 Rabbit Polyclonal Antibody
orb3071692-02 50 µL

C15orf32 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C15orf32 Rabbit Polyclonal Antibody
orb3071692-03 100 µL

C15orf32 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C15orf32 Rabbit Polyclonal Antibody
orb3071692-04 200 µL

C15orf32 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Chromozym-TH HCl
T30910 5 mg

Chromozym-TH HCl

Sign In for Pricing
View Details
Anti-Annexin A2/ANXA2 Antibody Picoband®, Cy3 Conjugate
PA1348-Cy3 100 µg/Vial

Anti-Annexin A2/ANXA2 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details