NTproBNP (1-76)
NT-proBNP is metabolized by the kidneys and is greatly affected by renal function, and ACE inhibitors/ARBs, β-blockers, adrenergic antagonists, and diuretics can reduce the concentration of NT-proBNP, so it is necessary to measure the basal level of NT-proBNP before drug treatment as a reference for diagnosis, prognosis, and efficacy evaluation.
Product Specifications
Purity
≥95%
Molecular Weight
8457.57
Notes
For research use only.
AA Sequence
HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGH
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10419147 96 Well
Bovine ATP synthase subunit g 2, mitochondrial (ATP5L2) ELISA kit
Sign In for Pricing
View Details NBP2-97282UV 0.1 mL
Rabbit Polyclonal CHMP2A Antibody [DyLight 350]
Sign In for Pricing
View Details