Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NTproBNP (1-76)

NT-proBNP is metabolized by the kidneys and is greatly affected by renal function, and ACE inhibitors/ARBs, β-blockers, adrenergic antagonists, and diuretics can reduce the concentration of NT-proBNP, so it is necessary to measure the basal level of NT-proBNP before drug treatment as a reference for diagnosis, prognosis, and efficacy evaluation.

Product Specifications

Purity

≥95%

Molecular Weight

8457.57

Notes

For research use only.

AA Sequence

HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FMN1 knockout cell line
ABC-KH5614 1 Vial

Human FMN1 knockout cell line

Sign In for Pricing
View Details
Mouse Monoclonal p21/CIP1/CDKN1A Antibody (CIP1/823 + DCS-60.2) [Janelia Fluor 549]
NBP2-47897JF549 0.1 mL

Mouse Monoclonal p21/CIP1/CDKN1A Antibody (CIP1/823 + DCS-60.2) [Janelia Fluor 549]

Sign In for Pricing
View Details
ZFP36L1  polyclonal antibody
BS79162 50ul

ZFP36L1 polyclonal antibody

Sign In for Pricing
View Details
Rabbit Polyclonal GADD45G Antibody
NBP3-00285-50ul 50 µL

Rabbit Polyclonal GADD45G Antibody

Sign In for Pricing
View Details
Mouse Transcription factor Sp8 (SP8) ELISA Kit
MBS7217699-01 48 Well

Mouse Transcription factor Sp8 (SP8) ELISA Kit

Sign In for Pricing
View Details
Mouse Transcription factor Sp8 (SP8) ELISA Kit
MBS7217699-02 96 Well

Mouse Transcription factor Sp8 (SP8) ELISA Kit

Sign In for Pricing
View Details