Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tyr-CRF (human, rat)

Tyr-CRF (human, rat)

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Molecular Weight

4920.73

Notes

For research use only.

AA Sequence

YSEEPPISLDLTFHLLREVLEMLEMARAEQLAQQAHSNRKLMEII-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-type Ca++ CP γ2 Lentiviral Activation Particles (h)
sc-411463-LAC 200 µL

L-type Ca++ CP γ2 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
A- (Benzoylamino) benzeneacetamide-d10
HY-W777774-01 100 mg

A- (Benzoylamino) benzeneacetamide-d10

Sign In for Pricing
View Details
A- (Benzoylamino) benzeneacetamide-d10
HY-W777774-02 1 g

A- (Benzoylamino) benzeneacetamide-d10

Sign In for Pricing
View Details
Anti-Geminin/GMNN Antibody Picoband® Fluoro488 Conjugated
A06060-3-Fluoro488 100 µg/Vial

Anti-Geminin/GMNN Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
SPATA17 Rabbit Polyclonal Antibody (BF350)
orb2474122 100 µL

SPATA17 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Human N-acetylaspartate synthetase ELISA Kit
orb1658813 96 Tests

Human N-acetylaspartate synthetase ELISA Kit

Sign In for Pricing
View Details