Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tyr-CRF (human, rat)

Tyr-CRF (human, rat)

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Molecular Weight

4920.73

Notes

For research use only.

AA Sequence

YSEEPPISLDLTFHLLREVLEMLEMARAEQLAQQAHSNRKLMEII-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMARCA4 Antibody, Biotin conjugated
MBS7044705-01 0.05 mg

SMARCA4 Antibody, Biotin conjugated

Sign In for Pricing
View Details
SMARCA4 Antibody, Biotin conjugated
MBS7044705-02 0.1 mg

SMARCA4 Antibody, Biotin conjugated

Sign In for Pricing
View Details
SMARCA4 Antibody, Biotin conjugated
MBS7044705-03 5x 0.1 mg

SMARCA4 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Tert-butyl 3,5-dimethyl-4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) benzoate
OR1083561 1 Each

Tert-butyl 3,5-dimethyl-4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) benzoate

Sign In for Pricing
View Details
Recombinant Human Kruppel Like Factor 5, Intestinal (KLF5)
RPU51692-01 50 µg

Recombinant Human Kruppel Like Factor 5, Intestinal (KLF5)

Sign In for Pricing
View Details
Recombinant Human Kruppel Like Factor 5, Intestinal (KLF5)
RPU51692-02 100 µg

Recombinant Human Kruppel Like Factor 5, Intestinal (KLF5)

Sign In for Pricing
View Details