Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tyr-CRF (human, rat)

Tyr-CRF (human, rat)

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Molecular Weight

4920.73

Notes

For research use only.

AA Sequence

YSEEPPISLDLTFHLLREVLEMLEMARAEQLAQQAHSNRKLMEII-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZC3HC1 Protein Vector (Rat) (pPB-N-His)
PV317295 500 ng

ZC3HC1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
KDELR3 Human Over-expression Lysate
orb1348999 100 µg

KDELR3 Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Anti-Human PAKα Polyclonal Antibody
PA89883HU-01 50 µg

Rabbit Anti-Human PAKα Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human PAKα Polyclonal Antibody
PA89883HU-02 100 µg

Rabbit Anti-Human PAKα Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human PAKα Polyclonal Antibody
PA89883HU-03 500 µg

Rabbit Anti-Human PAKα Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human PAKα Polyclonal Antibody
PA89883HU-04 1 mg

Rabbit Anti-Human PAKα Polyclonal Antibody

Sign In for Pricing
View Details