Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GHRF (1-44), human

Growth Hormone Releasing FactorGHRF (1-44), human Overview Properties Growth hormone-releasing factor (GHRF) is a hypothalamic peptide which positively regulates the synthesis and secretion of growth hormone in the anterior pituitary. The amino-acid sequence of a 43-residue GHRF peptide isolated from rat hypothalamus was recently determined.

Product Specifications

Purity

≥95%

Molecular Weight

5039.7

Notes

For research use only.

AA Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ST8SIA6 Protein Vector (Rat) (pPB-C-His)
PV308390 500 ng

ST8SIA6 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
FCAR Antibody
orb672352-01 50 µg

FCAR Antibody

Sign In for Pricing
View Details
FCAR Antibody
orb672352-02 100 µg

FCAR Antibody

Sign In for Pricing
View Details
Horse Protein FAM123B (FAM123B) ELISA Kit
MBS9398085-01 48 Well

Horse Protein FAM123B (FAM123B) ELISA Kit

Sign In for Pricing
View Details
Horse Protein FAM123B (FAM123B) ELISA Kit
MBS9398085-02 96 Well

Horse Protein FAM123B (FAM123B) ELISA Kit

Sign In for Pricing
View Details
Horse Protein FAM123B (FAM123B) ELISA Kit
MBS9398085-03 5x 96 Well

Horse Protein FAM123B (FAM123B) ELISA Kit

Sign In for Pricing
View Details