Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Protein Kinase C (530-558)

Protein Kinase C (530-558), a peptide fragment of protein kinase C (PKC), is a potent PKC activator. Protein Kinase C (530-558) significantly inhibits osteoclastic bone resorption.

Product Specifications

Field of Research

Signal Transduction

Purity

≥95%

Molecular Weight

3354.7

Notes

For research use only.

AA Sequence

LLYEMLAGQAPFEGEDEDELFQSIMEHNV-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-22 Protein, Mouse
UA040063-01 5 µg

IL-22 Protein, Mouse

Sign In for Pricing
View Details
IL-22 Protein, Mouse
UA040063-02 10 µg

IL-22 Protein, Mouse

Sign In for Pricing
View Details
IL-22 Protein, Mouse
UA040063-03 50 µg

IL-22 Protein, Mouse

Sign In for Pricing
View Details
IL-22 Protein, Mouse
UA040063-04 100 µg

IL-22 Protein, Mouse

Sign In for Pricing
View Details
IL-22 Protein, Mouse
UA040063-05 500 µg

IL-22 Protein, Mouse

Sign In for Pricing
View Details
IL-22 Protein, Mouse
UA040063-06 1 mg

IL-22 Protein, Mouse

Sign In for Pricing
View Details