Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Protein Kinase C (530-558)

Protein Kinase C (530-558), a peptide fragment of protein kinase C (PKC), is a potent PKC activator. Protein Kinase C (530-558) significantly inhibits osteoclastic bone resorption.

Product Specifications

Field of Research

Signal Transduction

Purity

≥95%

Molecular Weight

3354.7

Notes

For research use only.

AA Sequence

LLYEMLAGQAPFEGEDEDELFQSIMEHNV-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Enolase 1/Non-neural enolase Recombinant Protein
PROTP06733-100ug 100 µg

Human Enolase 1/Non-neural enolase Recombinant Protein

Sign In for Pricing
View Details
Lentiviral human SETD4 sgRNA gene knockout kit - Lentiviral human SETD4 sgRNA gene knockout kit (plasmid)
GTR15373466 1 Vial

Lentiviral human SETD4 sgRNA gene knockout kit - Lentiviral human SETD4 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
MKRN8P AAV Vector (Human) (CMV)
30180101 1 µg

MKRN8P AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS800030 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
HADHA (E-8) Alexa Fluor® 680
sc-374497 AF680 200 µg/mL

HADHA (E-8) Alexa Fluor® 680

Sign In for Pricing
View Details
AKTIP Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
11715064 1.0 µg DNA

AKTIP Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details