Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Protein Kinase C (530-558)

Protein Kinase C (530-558), a peptide fragment of protein kinase C (PKC), is a potent PKC activator. Protein Kinase C (530-558) significantly inhibits osteoclastic bone resorption.

Product Specifications

Field of Research

Signal Transduction

Purity

≥95%

Molecular Weight

3354.7

Notes

For research use only.

AA Sequence

LLYEMLAGQAPFEGEDEDELFQSIMEHNV-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Potassium Voltage-Gated Channel Subfamily C Member 4 Phospho-Ser15 (KCNC4 pS15) Antibody
abx325339-01 50 µg

Potassium Voltage-Gated Channel Subfamily C Member 4 Phospho-Ser15 (KCNC4 pS15) Antibody

Sign In for Pricing
View Details
Potassium Voltage-Gated Channel Subfamily C Member 4 Phospho-Ser15 (KCNC4 pS15) Antibody
abx325339-02 100 µg

Potassium Voltage-Gated Channel Subfamily C Member 4 Phospho-Ser15 (KCNC4 pS15) Antibody

Sign In for Pricing
View Details
Recombinant Candida maltosa Cysteine desulfurase, mitochondrial (SPL1), partial
MBS1028733 Inquire

Recombinant Candida maltosa Cysteine desulfurase, mitochondrial (SPL1), partial

Sign In for Pricing
View Details
Canine Giardia lamblia Antigen ELISA KIT
ED0035Ca-01 96 Well

Canine Giardia lamblia Antigen ELISA KIT

Sign In for Pricing
View Details
MRPL49 Polyclonal Antibody
E55A03692 100 µg

MRPL49 Polyclonal Antibody

Sign In for Pricing
View Details
SLC14A2 Antibody (N-Term)
E45R33641G-1 100 µL

SLC14A2 Antibody (N-Term)

Sign In for Pricing
View Details