Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rec IGF-II (1-67) (human)

Approx. ED50 = 0.1 ng/mL IGF-II seems to be specifically involved in fetal growth, but otherwise shows similar biological activities to IGF-I.

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Molecular Weight

524.564

Notes

For research use only.

AA Sequence

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CARS1 (NM_139273) Human Mass Spec Standard
PH324149 10 µg

CARS1 (NM_139273) Human Mass Spec Standard

Sign In for Pricing
View Details
Kcnd1 Rat shRNA Plasmid (Locus ID 116695)
TL704346 1 Kit

Kcnd1 Rat shRNA Plasmid (Locus ID 116695)

Sign In for Pricing
View Details
DR1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
18588126 3x 1.0µg DNA

DR1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Hepatocyte Specific Antigen
MBS344181-01 0.1 mL (Concentrate)

Hepatocyte Specific Antigen

Sign In for Pricing
View Details
Hepatocyte Specific Antigen
MBS344181-02 7 mL (RTU)

Hepatocyte Specific Antigen

Sign In for Pricing
View Details
Hepatocyte Specific Antigen
MBS344181-03 1 mL (Concentrate)

Hepatocyte Specific Antigen

Sign In for Pricing
View Details