Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rec IGF-II (1-67) (human)

Approx. ED50 = 0.1 ng/mL IGF-II seems to be specifically involved in fetal growth, but otherwise shows similar biological activities to IGF-I.

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Molecular Weight

524.564

Notes

For research use only.

AA Sequence

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Nitroso Cetirizine EP Impurity A-d8
CS-O-47314 1 Each

N-Nitroso Cetirizine EP Impurity A-d8

Sign In for Pricing
View Details
Recombinant Pseudomonas putida Probable intracellular septation protein A (PputGB1_4007)
MBS1214468 Inquire

Recombinant Pseudomonas putida Probable intracellular septation protein A (PputGB1_4007)

Sign In for Pricing
View Details
GCNT1P5 3'UTR Luciferase Stable Cell Line
TU008689 1.0 mL

GCNT1P5 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
BRCA2 Rabbit pAb, HRP conjugated
orb3000841 100 µL

BRCA2 Rabbit pAb, HRP conjugated

Sign In for Pricing
View Details
Lithium Meta Borate Anhydrous AR 99.5%
565955 250 g

Lithium Meta Borate Anhydrous AR 99.5%

Sign In for Pricing
View Details
S2553 Antibody
C46075-01 50 µL

S2553 Antibody

Sign In for Pricing
View Details