Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rec IGF-II (1-67) (human)

Approx. ED50 = 0.1 ng/mL IGF-II seems to be specifically involved in fetal growth, but otherwise shows similar biological activities to IGF-I.

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Molecular Weight

524.564

Notes

For research use only.

AA Sequence

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AHNAK Nucleoprotein (Desmoyokin, AHNAKRS, MGC5395)
MBS601415-01 0.1 mg

AHNAK Nucleoprotein (Desmoyokin, AHNAKRS, MGC5395)

Sign In for Pricing
View Details
AHNAK Nucleoprotein (Desmoyokin, AHNAKRS, MGC5395)
MBS601415-02 5x 0.1 mg

AHNAK Nucleoprotein (Desmoyokin, AHNAKRS, MGC5395)

Sign In for Pricing
View Details
BAI1 Antibody
MBS7128618-01 0.05 mL

BAI1 Antibody

Sign In for Pricing
View Details
BAI1 Antibody
MBS7128618-02 0.1 mL

BAI1 Antibody

Sign In for Pricing
View Details
BAI1 Antibody
MBS7128618-03 5x 0.1 mL

BAI1 Antibody

Sign In for Pricing
View Details
Pyrene-PEG-OH (MW 2000)
TCL-02104-01 10 mg

Pyrene-PEG-OH (MW 2000)

Sign In for Pricing
View Details