Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rec IGF-II (1-67) (human)

Approx. ED50 = 0.1 ng/mL IGF-II seems to be specifically involved in fetal growth, but otherwise shows similar biological activities to IGF-I.

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Molecular Weight

524.564

Notes

For research use only.

AA Sequence

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pwwp2b (NM_001098636) Mouse Tagged ORF Clone Lentiviral Particle
MR212173L3V 200 µL

Pwwp2b (NM_001098636) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RCAN3 (m) -PR
sc-72778-PR 10 µM - 20 µL

RCAN3 (m) -PR

Sign In for Pricing
View Details
2010107G23Rik shRNA (m) Lentiviral Particles
sc-108601-V 200 µL

2010107G23Rik shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Anti-Mouse CD90.1 Monoclonal Antibody (Biotin Conjugated)
MBS4516742-01 0.05 mg

Anti-Mouse CD90.1 Monoclonal Antibody (Biotin Conjugated)

Sign In for Pricing
View Details
Anti-Mouse CD90.1 Monoclonal Antibody (Biotin Conjugated)
MBS4516742-02 0.1 mg

Anti-Mouse CD90.1 Monoclonal Antibody (Biotin Conjugated)

Sign In for Pricing
View Details
Anti-Mouse CD90.1 Monoclonal Antibody (Biotin Conjugated)
MBS4516742-03 5x 0.1 mg

Anti-Mouse CD90.1 Monoclonal Antibody (Biotin Conjugated)

Sign In for Pricing
View Details