Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Tyr0]-Urocortin (rat)

(Tyr0) -Urocortin, rat is a high-affinity agonist of corticotropin-releasing factor receptor type 1 (CRF-R1) and type 2 (CRF-R2) . (Tyr0) -Urocortin, rat shows inhibitory binding constants (Ki) of 1-2 nM.

Product Specifications

Purity

≥95%

Molecular Weight

4870.55

Notes

For research use only.

AA Sequence

YDDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSNOR, ADH5 Antibody
abx233678 100 µg

GSNOR, ADH5 Antibody

Sign In for Pricing
View Details
RPS27L antibody
FNab07472 100 µg

RPS27L antibody

Sign In for Pricing
View Details
KRT18P36 Protein Vector (Human) (pPB-C-His)
PV089594 500 ng

KRT18P36 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
PTK9 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-4169R-BF750 100 µL

PTK9 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
SLC2A2 Rabbit Polyclonal Antibody (Biotin)
orb2123338 100 µL

SLC2A2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
OASL CRISPR All-in-one AAV vector set (with saCas9)(Human)
32399151 3x 1.0 µg DNA

OASL CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details