Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Tyr0]-Urocortin (rat)

(Tyr0) -Urocortin, rat is a high-affinity agonist of corticotropin-releasing factor receptor type 1 (CRF-R1) and type 2 (CRF-R2) . (Tyr0) -Urocortin, rat shows inhibitory binding constants (Ki) of 1-2 nM.

Product Specifications

Purity

≥95%

Molecular Weight

4870.55

Notes

For research use only.

AA Sequence

YDDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human HSPA6 Protein, N-His
bs-100926P-01 20 µg

Recombinant Human HSPA6 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human HSPA6 Protein, N-His
bs-100926P-02 50 µg

Recombinant Human HSPA6 Protein, N-His

Sign In for Pricing
View Details
Alcian Blue Stain Kit, pH 1.0
G1563 3x 50 mL

Alcian Blue Stain Kit, pH 1.0

Sign In for Pricing
View Details
Propyl red
HY-D0796 1 Each

Propyl red

Sign In for Pricing
View Details
Recombinant Danio rerio Dead end protein 1 (dnd)
MBS1341049-01 0.02 mg (E-Coli)

Recombinant Danio rerio Dead end protein 1 (dnd)

Sign In for Pricing
View Details
Recombinant Danio rerio Dead end protein 1 (dnd)
MBS1341049-02 0.02 mg (Yeast)

Recombinant Danio rerio Dead end protein 1 (dnd)

Sign In for Pricing
View Details