Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prepro VIP (81-122) (human)

Prepro VIP (81-122) (human)

Product Specifications

Purity

≥95%

Molecular Weight

4552.22

Notes

For research use only.

AA Sequence

HADGVFTSKLLGQLSAKKYLESLMGKRVSSNISEDPVPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glassware Washer BGLW-101
BGLW-101 1 Unit

Glassware Washer BGLW-101

Sign In for Pricing
View Details
CTDSP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G2]
TA502227AM 100 µL

CTDSP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G2]

Sign In for Pricing
View Details
Human PCDHB15 activation kit by CRISPRa
GA111113 1 Kit

Human PCDHB15 activation kit by CRISPRa

Sign In for Pricing
View Details
Polystyrene AM PAL
H10022.25G 25 g

Polystyrene AM PAL

Sign In for Pricing
View Details
PKC theta (PRKCQ) pSer695 Rabbit Polyclonal Antibody
AP02450PU-S 50 µL

PKC theta (PRKCQ) pSer695 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SIRT5 Rabbit Monoclonal Antibody
TA422800 100 µL

SIRT5 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details