Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prepro VIP (81-122) (human)

Prepro VIP (81-122) (human)

Product Specifications

Purity

≥95%

Molecular Weight

4552.22

Notes

For research use only.

AA Sequence

HADGVFTSKLLGQLSAKKYLESLMGKRVSSNISEDPVPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benoxaprofen Glucuronide
TRC-B120150-5MG 5 mg

Benoxaprofen Glucuronide

Sign In for Pricing
View Details
Dansyl Acid-d6
TRC-D172862-25MG 25 mg

Dansyl Acid-d6

Sign In for Pricing
View Details
N-Acetyl-D-glucosamine
TRC-A178000-10G 10 g

N-Acetyl-D-glucosamine

Sign In for Pricing
View Details
CARHSP1 (NM_001042476) Human Over-expression Lysate
LC425754 20 µg

CARHSP1 (NM_001042476) Human Over-expression Lysate

Sign In for Pricing
View Details
Chst3 Mouse Gene Knockout Kit (CRISPR)
KN503327 1 Kit

Chst3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Storage Box
R1020-O 5 Units/Pack

Storage Box

Sign In for Pricing
View Details