Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Tyr0]-BNP-32 (human)

[Tyr0]-BNP-32 (human)

Product Specifications

Purity

≥95%

Molecular Weight

3627.28

Notes

For research use only.

AA Sequence

YSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: Cys11-Cys27)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Breast
CS804641 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
CDK5RAP3 Antibody
KC-41409-01 50 μL

CDK5RAP3 Antibody

Sign In for Pricing
View Details
CDK5RAP3 Antibody
KC-41409-02 100 µL

CDK5RAP3 Antibody

Sign In for Pricing
View Details
CDK5RAP3 Antibody
KC-41409-03 1 mL

CDK5RAP3 Antibody

Sign In for Pricing
View Details
Human MIF activation kit by CRISPRa
GA102909 1 Kit

Human MIF activation kit by CRISPRa

Sign In for Pricing
View Details
Screw-cap Microtube
C2230 1000 Units/Case

Screw-cap Microtube

Sign In for Pricing
View Details