Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Tyr0]-BNP-32 (human)

[Tyr0]-BNP-32 (human)

Product Specifications

Purity

≥95%

Molecular Weight

3627.28

Notes

For research use only.

AA Sequence

YSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: Cys11-Cys27)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CCL11 Protein (Trx Tag)
PDEM100147-01 20 µg

Recombinant Mouse CCL11 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse CCL11 Protein (Trx Tag)
PDEM100147-02 100 µg

Recombinant Mouse CCL11 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse CCL11 Protein (Trx Tag)
PDEM100147-03 500 µg

Recombinant Mouse CCL11 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse CCL11 Protein (Trx Tag)
PDEM100147-04 1 mg

Recombinant Mouse CCL11 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant ANXA1 Antibody
RC-6892-01 50 μL

Recombinant ANXA1 Antibody

Sign In for Pricing
View Details
Recombinant ANXA1 Antibody
RC-6892-02 100 µL

Recombinant ANXA1 Antibody

Sign In for Pricing
View Details