Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PACAP-38, amide, frog

PACAP-38, amide, frog

Product Specifications

Purity

≥95%

Molecular Weight

4548.38

Notes

For research use only.

AA Sequence

HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRIKNK-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Cdk4 Rabbit pAb
GB11238-2-100 100 μL

Anti-Cdk4 Rabbit pAb

Sign In for Pricing
View Details
Anti-CRMP5 Rabbit Monoclonal Antibody
MA2046-.1 100 µL

Anti-CRMP5 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
(4S) -6-Chloro-4- (cyclopropylethynyl) -1,4-dihydro-2- (4-methoxyphenyl) -4- (trifluoromethyl) -2H-3,1-benzoxazine (Mixture of 2 Diastereomers)
006155 5 mg

(4S) -6-Chloro-4- (cyclopropylethynyl) -1,4-dihydro-2- (4-methoxyphenyl) -4- (trifluoromethyl) -2H-3,1-benzoxazine (Mixture of 2 Diastereomers)

Sign In for Pricing
View Details
Human PDSS2 Protein Lysate
MBS8417022-01 0.02 mg

Human PDSS2 Protein Lysate

Sign In for Pricing
View Details
Human PDSS2 Protein Lysate
MBS8417022-02 5x 0.02 mg

Human PDSS2 Protein Lysate

Sign In for Pricing
View Details
IL-1 beta/IL-1F2 Protein, Human, Recombinant
TMPY-01049-01 5 µg

IL-1 beta/IL-1F2 Protein, Human, Recombinant

Sign In for Pricing
View Details