Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PACAP-38, amide, frog

PACAP-38, amide, frog

Product Specifications

Purity

≥95%

Molecular Weight

4548.38

Notes

For research use only.

AA Sequence

HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRIKNK-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MALT1 (MALT-Lymphoma Marker) Antibody - With BSA and Azide
orb1463047-01 20 µg

MALT1 (MALT-Lymphoma Marker) Antibody - With BSA and Azide

Sign In for Pricing
View Details
MALT1 (MALT-Lymphoma Marker) Antibody - With BSA and Azide
orb1463047-02 100 µg

MALT1 (MALT-Lymphoma Marker) Antibody - With BSA and Azide

Sign In for Pricing
View Details
BMI1 Antibody
MBS9200421-01 0.08 mL

BMI1 Antibody

Sign In for Pricing
View Details
BMI1 Antibody
MBS9200421-02 0.4 mL

BMI1 Antibody

Sign In for Pricing
View Details
BMI1 Antibody
MBS9200421-03 5x 0.4 mL

BMI1 Antibody

Sign In for Pricing
View Details
LGALS3 Antibody Blocking peptide
orb1456815 500 µg

LGALS3 Antibody Blocking peptide

Sign In for Pricing
View Details