Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNP-32 , porcine

The source of Brain natriuretic peptide-32 is pig (Sus scrofa) .

Product Specifications

Purity

≥95%

Molecular Weight

3570.17

Notes

For research use only.

AA Sequence

SPKTMRDSGCFGRRLDRIGSLSGLGCNVLRRY (Disulfide bridge:Cys10-Cys26)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Compound NP-024002
MBS5793172 Inquire

Compound NP-024002

Sign In for Pricing
View Details
Rabbit anti-TRMT11 Antibody
YLD7893-01 50 µL

Rabbit anti-TRMT11 Antibody

Sign In for Pricing
View Details
Rabbit anti-TRMT11 Antibody
YLD7893-02 100 µL

Rabbit anti-TRMT11 Antibody

Sign In for Pricing
View Details
OR5D18 Double Nickase Plasmid (h)
sc-415056-NIC 20 µg

OR5D18 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Benzoic Acid
C09969 50 mg

Benzoic Acid

Sign In for Pricing
View Details
AGXT2 antibody
70R-5302 100 µL

AGXT2 antibody

Sign In for Pricing
View Details