Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNP-32 , porcine

The source of Brain natriuretic peptide-32 is pig (Sus scrofa) .

Product Specifications

Purity

≥95%

Molecular Weight

3570.17

Notes

For research use only.

AA Sequence

SPKTMRDSGCFGRRLDRIGSLSGLGCNVLRRY (Disulfide bridge:Cys10-Cys26)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CDC42 (Ser71) Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61349R-BF405-01 20 µL

Phospho-CDC42 (Ser71) Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Phospho-CDC42 (Ser71) Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61349R-BF405-02 100 µL

Phospho-CDC42 (Ser71) Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
E/E004/NT-PP-PHOLUMB-200x200/1-B Safety & Regulatory Compliance Signs (No Adhesive)
836539 1 Pack (1 Panel (s) x 1 Pack)

E/E004/NT-PP-PHOLUMB-200x200/1-B Safety & Regulatory Compliance Signs (No Adhesive)

Sign In for Pricing
View Details
AdmiRa-rno-mir-136 Virus
mr0047 250 µL

AdmiRa-rno-mir-136 Virus

Sign In for Pricing
View Details
MYLPF Protein Vector (Rat) (pPM-C-HA)
31270026 500 ng

MYLPF Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Polyclonal FABP5/E-FABP Antibody
NBP2-38659 0.1 mL

Rabbit Polyclonal FABP5/E-FABP Antibody

Sign In for Pricing
View Details